![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.7: OmpA-like [103088] (2 families) ![]() |
![]() | Family d.79.7.0: automated matches [195454] (1 protein) not a true family |
![]() | Protein automated matches [195455] (14 species) not a true protein |
![]() | Species Capnocytophaga gingivalis [TaxId:553178] [342874] (1 PDB entry) |
![]() | Domain d5wtpb1: 5wtp B:335-454 [342882] Other proteins in same PDB: d5wtpa2, d5wtpb2, d5wtpc2 automated match to d4pwta_ complexed with so4 |
PDB Entry: 5wtp (more details), 2.15 Å
SCOPe Domain Sequences for d5wtpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wtpb1 d.79.7.0 (B:335-454) automated matches {Capnocytophaga gingivalis [TaxId: 553178]} epdekeqkqlnqyaktilfdtgkatikfqsaevlnqiinvlkkypnsrfrieghtdstgk kaknmilsqnradavkvyliqggidagrlesqgfgpekpiasnknkkgrelnrrveinli
Timeline for d5wtpb1:
![]() Domains from other chains: (mouse over for more information) d5wtpa1, d5wtpa2, d5wtpc1, d5wtpc2 |