Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (60 species) not a true protein |
Species Hypericum androsaemum [TaxId:140968] [342879] (1 PDB entry) |
Domain d5ucob2: 5uco B:240-394 [342881] automated match to d3wd7a2 |
PDB Entry: 5uco (more details), 2.85 Å
SCOPe Domain Sequences for d5ucob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ucob2 c.95.1.0 (B:240-394) automated matches {Hypericum androsaemum [TaxId: 140968]} vfnilsasqtivpgsdgaitahfyemgmsyflkedviplfrdniaavmeeafsplgvsdw nslfysihpggrgiidgvagnlgikdenlvatrhvlgeygnmgsacvmfildelrksskv ngkpttgdgkefgcliglgpgltveavvlqsvpil
Timeline for d5ucob2: