![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85962] [188666] (10 PDB entries) |
![]() | Domain d5wt5a_: 5wt5 A: [342878] automated match to d4eb5a_ complexed with hcs, ipa |
PDB Entry: 5wt5 (more details), 1.9 Å
SCOPe Domain Sequences for d5wt5a_:
Sequence, based on SEQRES records: (download)
>d5wt5a_ c.67.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]} vqriyldnnattridpkvkeimdpflrdhygnpsslhqfgtethpaiaealdklykgina rdiddviitscatesnnwvlkgvyfdeclkkgknhivttvaehpavrstcnfleslgvev tylpinehgsitaeqvreaitektalvsvmwannetglifpieeigaickekgvlfhtda vqaigkipvdvlkanadflsfsahkfhgpkgigglyirsgvgltplfhggehmngrrsgt lnvpyivgmgeamklavehldyekevvgklrdkleeallkipdvmvvgdrihrvpnttlv svrgiegeamlwdlnrsniaastgsacasedleanpvmvaigaskelahtairlslsrfn teaeidktievfsqaavrlrniss
>d5wt5a_ c.67.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]} vqriyldnnattridpkvkeimdpflrdhygnpsslhqfgtethpaiaealdklykgina rdiddviitscatesnnwvlkgvyfdeclkkgknhivttvaehpavrstcnfleslgvev tylpinehgsitaeqvreaitektalvsvmwannetglifpieeigaickekgvlfhtda vqaigkipvdvlkanadflsfsahkfhgpkgigglyirsgvgltplfhggehmngrrsgt lnvpyivgmgeamklavehldyekevvgklrdkleeallkipdvmvvgdrihrvpnttlv svrgiegeamlwdlnrsniaastgsachtairlslsrfnteaeidktievfsqaavrlrn iss
Timeline for d5wt5a_: