SCOPe 2.08: Domain d5mvgb1: 5mvg B:3-107

Lineage for d5mvgb1 (5mvg B:3-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5mvgb1: 5mvg B:3-107 [342864]
   Other proteins in same PDB: d5mvga1, d5mvgb2
   automated match to d4ocrl1
   complexed with gol

Details for d5mvgb1

PDB Entry: 5mvg, 2.2 Å

PDB Description: crystal structure of non-amyloidogenic light chain dimer m7

PDB Compounds: (B:) light chain dimer

SCOPe Domain Sequences for d5mvgb1:

Sequence; same for both SEQRES and ATOM records:

>d5mvgb1 b.1.1.0 (B:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltqdpavsvalgqtvkitcqgdslrmyyaswyqqkpaqapvlviyaeknrpsgipdrfs
asssgstasltitgaqaedeadyycnsrdnsgdhlvfgggtkltv

Timeline for d5mvgb1:

• d5mvgb1 first appeared in SCOPe 2.06
  
• d5mvgb1 appears in SCOPe 2.07