SCOPe 2.08: Domain d5w8qb1: 5w8q B:10-229

Lineage for d5w8qb1 (5w8q B:10-229)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Apple (Malus domestica) [TaxId:3750] [342831] (3 PDB entries)

8. Domain d5w8qb1: 5w8q B:10-229 [342862]
   automated match to d1u0va1
   complexed with bu4

Details for d5w8qb1

PDB Entry: 5w8q, 1.17 Å

PDB Description: crystal structure of biphenyl synthase from malus domestica

PDB Compounds: (B:) BIS3 biphenyl synthase

SCOPe Domain Sequences for d5w8qb1:

Sequence; same for both SEQRES and ATOM records:

>d5w8qb1 c.95.1.0 (B:10-229) automated matches {Apple (Malus domestica) [TaxId: 3750]}
qhakilaigtanppnvyhqkdypdflfrvtknehrtdlrekfdriceksrtkkrylhlte
emlkanpniytygapsldvrqdicnievpklgqeaalkaikewgqpisrithlifctasc
vdmpgcdfqlikllgldpsvtrtmiyeagcyagatvlrmakdfaennkgarvlvvcaeit
tvffhgltdthldilvgqalfadgasavivganpepeier

Timeline for d5w8qb1:

• d5w8qb1 first appeared in SCOPe 2.06
  
• d5w8qb1 appears in SCOPe 2.07