SCOPe 2.08: Domain d5u4lb_: 5u4l B:

Lineage for d5u4lb_ (5u4l B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries)

8. Domain d5u4lb_: 5u4l B: [342860]
   Other proteins in same PDB: d5u4la_
   automated match to d1igmh_
   complexed with cl, edo, po4

Details for d5u4lb_

PDB Entry: 5u4l, 2.5 Å

PDB Description: rta-v1c7_g29r-high-salt

PDB Compounds: (B:) V1C7 VHH antibody G29R variant

SCOPe Domain Sequences for d5u4lb_:

Sequence; same for both SEQRES and ATOM records:

>d5u4lb_ b.1.1.0 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
snaqvqlvesggglvqpggslrlscvasefsrftldyyaigwfrqapgkereglssisss
sdgftsysdsvkgrftisrdnakntvylqmnslkpedtavyycaarlggwasfspqeydy
wgqgtqvtvss

Timeline for d5u4lb_:

• d5u4lb_ first appeared in SCOPe 2.06
  
• d5u4lb_ appears in SCOPe 2.07