Lineage for d5wc4a1 (5wc4 A:10-229)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917374Species Apple (Malus domestica) [TaxId:3750] [342831] (3 PDB entries)
  8. 2917379Domain d5wc4a1: 5wc4 A:10-229 [342853]
    automated match to d1u0va1
    complexed with bu4, byc

Details for d5wc4a1

PDB Entry: 5wc4 (more details), 1.2 Å

PDB Description: crystal structure of biphenyl synthase from malus domestic complexed with benzoyl-coa
PDB Compounds: (A:) BIS3 biphenyl synthase

SCOPe Domain Sequences for d5wc4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wc4a1 c.95.1.0 (A:10-229) automated matches {Apple (Malus domestica) [TaxId: 3750]}
qhakilaigtanppnvyhqkdypdflfrvtknehrtdlrekfdriceksrtkkrylhlte
emlkanpniytygapsldvrqdicnievpklgqeaalkaikewgqpisrithlifctasc
vdmpgcdfqlikllgldpsvtrtmiyeagcyagatvlrmakdfaennkgarvlvvcaeit
tvffhgltdthldilvgqalfadgasavivganpepeier

SCOPe Domain Coordinates for d5wc4a1:

Click to download the PDB-style file with coordinates for d5wc4a1.
(The format of our PDB-style files is described here.)

Timeline for d5wc4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5wc4a2