Lineage for d5on9a_ (5on9 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521806Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 2521811Species Escherichia coli [TaxId:562] [102695] (28 PDB entries)
  8. 2521843Domain d5on9a_: 5on9 A: [342847]
    automated match to d1zlqa1
    complexed with 9yh, act, cl, dtt, fe, gol

Details for d5on9a_

PDB Entry: 5on9 (more details), 1.7 Å

PDB Description: crystal structure of nika in complex with reduced fe-l1 (n-(2- hydroxybenzyl)-n'-(2-thiomethylbenzyl)-n,n'-ethylenediamine diacetic acid)
PDB Compounds: (A:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d5on9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5on9a_ c.94.1.1 (A:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
apdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgk
twtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqit
lksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrn
enywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtq
lsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpya
nlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiq
admrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqa
qqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelg
nipyapiateipfeqikp

SCOPe Domain Coordinates for d5on9a_:

Click to download the PDB-style file with coordinates for d5on9a_.
(The format of our PDB-style files is described here.)

Timeline for d5on9a_: