SCOPe 2.08: Domain d5w11b_: 5w11 B:

Lineage for d5w11b_ (5w11 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold
   automatically mapped to Pfam PF00840

6. Protein automated matches [190170] (17 species)
   not a true protein

7. Species Myceliophthora thermophila [TaxId:78579] [342842] (1 PDB entry)

8. Domain d5w11b_: 5w11 B: [342843]
   automated match to d1cela_
   complexed with 144, man

Details for d5w11b_

PDB Entry: 5w11, 2.31 Å

PDB Description: biochemical and structural insights into the catalytic mechanism of thermostable cellobiohydrolase cel7a from industrially relevant fungus myceliophthora thermophila

PDB Compounds: (B:) glucanase

SCOPe Domain Sequences for d5w11b_:

Sequence; same for both SEQRES and ATOM records:

>d5w11b_ b.29.1.10 (B:) automated matches {Myceliophthora thermophila [TaxId: 78579]}
enactltaenhpsltwskctsggsctsvqgsitidanwrwthrtdsatncyegnkwdtsy
csdgpscaskccidgadysstygittsgnslnlkfvtkgqystnigsrtylmesdtkyqm
fqllgneftfdvdvsnlgcglngalyfvsmdadggmskysgnkagakygtgycdsqcprd
lkfingeanvenwqsstndanagtgkygsccsemdvweannmaaaftphpctvigqsrce
gdscggtystdryagicdpdgcdfnsyrqgnktfygkgmtvdttkkitvvtqflknsage
lseikrfyvqngkvipnsestipgvegnsitqdwcdrqkaafgdvtdfqdkggmvqmgka
lagpmvlvmsiwddhavnmlwldstwpidgagkpgaergacpttsgvpaeveaeapnsnv
ifsnirfgpigstvsglpdg

Timeline for d5w11b_:

• d5w11b_ first appeared in SCOPe 2.06
  
• d5w11b_ appears in SCOPe 2.07