Lineage for d5w11b_ (5w11 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779993Protein automated matches [190170] (17 species)
    not a true protein
  7. 2780042Species Myceliophthora thermophila [TaxId:78579] [342842] (1 PDB entry)
  8. 2780044Domain d5w11b_: 5w11 B: [342843]
    automated match to d1cela_
    complexed with 144, man

Details for d5w11b_

PDB Entry: 5w11 (more details), 2.31 Å

PDB Description: biochemical and structural insights into the catalytic mechanism of thermostable cellobiohydrolase cel7a from industrially relevant fungus myceliophthora thermophila
PDB Compounds: (B:) glucanase

SCOPe Domain Sequences for d5w11b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w11b_ b.29.1.10 (B:) automated matches {Myceliophthora thermophila [TaxId: 78579]}
enactltaenhpsltwskctsggsctsvqgsitidanwrwthrtdsatncyegnkwdtsy
csdgpscaskccidgadysstygittsgnslnlkfvtkgqystnigsrtylmesdtkyqm
fqllgneftfdvdvsnlgcglngalyfvsmdadggmskysgnkagakygtgycdsqcprd
lkfingeanvenwqsstndanagtgkygsccsemdvweannmaaaftphpctvigqsrce
gdscggtystdryagicdpdgcdfnsyrqgnktfygkgmtvdttkkitvvtqflknsage
lseikrfyvqngkvipnsestipgvegnsitqdwcdrqkaafgdvtdfqdkggmvqmgka
lagpmvlvmsiwddhavnmlwldstwpidgagkpgaergacpttsgvpaeveaeapnsnv
ifsnirfgpigstvsglpdg

SCOPe Domain Coordinates for d5w11b_:

Click to download the PDB-style file with coordinates for d5w11b_.
(The format of our PDB-style files is described here.)

Timeline for d5w11b_: