SCOPe 2.06: Domain d5uc5a2: 5uc5 A:236-388

Lineage for d5uc5a2 (5uc5 A:236-388)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Malus domestica [TaxId:3750] [342831] (3 PDB entries)

8. Domain d5uc5a2: 5uc5 A:236-388 [342841]
   Other proteins in same PDB: d5uc5a1, d5uc5b1
   automated match to d1bi5a2

Details for d5uc5a2

PDB Entry: 5uc5, 2.1 Å

PDB Description: chalcone synthase from malus domestica

PDB Compounds: (A:) CHS2 chalcone synthase

SCOPe Domain Sequences for d5uc5a2:

Sequence; same for both SEQRES and ATOM records:

>d5uc5a2 c.95.1.0 (A:236-388) automated matches {Malus domestica [TaxId: 3750]}
lfelvsaaqtilpdsdgaidghlrevgltfhllkdvpgliskniekslneafkpigisdw
nslfwiahpggpaildqvesklalkpekleatrqvlsnygnmssacvlfildevrrkste
kglrttgeglewgvlfgfgpgltvetvvlhsva

Timeline for d5uc5a2:

• d5uc5a2 is new in SCOPe 2.06-stable
  
• d5uc5a2 appears in SCOPe 2.07
  
• d5uc5a2 appears in the current release, SCOPe 2.08