SCOPe 2.08: Domain d5u4mb_: 5u4m B:

Lineage for d5u4mb_ (5u4m B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d5u4mb_: 5u4m B: [342833]
   Other proteins in same PDB: d5u4ma_
   automated match to d3qskb_
   complexed with cl

Details for d5u4mb_

PDB Entry: 5u4m, 2.5 Å

PDB Description: rta-v1c7-g29r-no_salt

PDB Compounds: (B:) V1C7 VHH antibody

SCOPe Domain Sequences for d5u4mb_:

Sequence; same for both SEQRES and ATOM records:

>d5u4mb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
naqvqlvesggglvqpggslrlscvasefsrftldyyaigwfrqapgkereglssissss
dgftsysdsvkgrftisrdnakntvylqmnslkpedtavyycaarlggwasfspqeydyw
gqgtqvtvs

Timeline for d5u4mb_:

• d5u4mb_ first appeared in SCOPe 2.06
  
• d5u4mb_ appears in SCOPe 2.07