| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
| Domain d5u4mb_: 5u4m B: [342833] Other proteins in same PDB: d5u4ma_ automated match to d3qskb_ complexed with cl |
PDB Entry: 5u4m (more details), 2.5 Å
SCOPe Domain Sequences for d5u4mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u4mb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
naqvqlvesggglvqpggslrlscvasefsrftldyyaigwfrqapgkereglssissss
dgftsysdsvkgrftisrdnakntvylqmnslkpedtavyycaarlggwasfspqeydyw
gqgtqvtvs
Timeline for d5u4mb_: