| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (83 species) not a true protein |
| Species Apple (Malus domestica) [TaxId:3750] [342831] (3 PDB entries) |
| Domain d5uc5b2: 5uc5 B:236-388 [342832] Other proteins in same PDB: d5uc5a1, d5uc5b1 automated match to d1bi5a2 |
PDB Entry: 5uc5 (more details), 2.1 Å
SCOPe Domain Sequences for d5uc5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uc5b2 c.95.1.0 (B:236-388) automated matches {Apple (Malus domestica) [TaxId: 3750]}
lfelvsaaqtilpdsdgaidghlrevgltfhllkdvpgliskniekslneafkpigisdw
nslfwiahpggpaildqvesklalkpekleatrqvlsnygnmssacvlfildevrrkste
kglrttgeglewgvlfgfgpgltvetvvlhsva
Timeline for d5uc5b2: