SCOPe 2.06: Domain d5uc5b1: 5uc5 B:2-235

Lineage for d5uc5b1 (5uc5 B:2-235)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein automated matches [226868] (3 species)
   not a true protein

7. Species Malus domestica [TaxId:3750] [342829] (1 PDB entry)

8. Domain d5uc5b1: 5uc5 B:2-235 [342830]
   Other proteins in same PDB: d5uc5a2, d5uc5b2
   automated match to d1cmla1

Details for d5uc5b1

PDB Entry: 5uc5, 2.1 Å

PDB Description: chalcone synthase from malus domestica

PDB Compounds: (B:) CHS2 chalcone synthase

SCOPe Domain Sequences for d5uc5b1:

Sequence; same for both SEQRES and ATOM records:

>d5uc5b1 c.95.1.2 (B:2-235) automated matches {Malus domestica [TaxId: 3750]}
vtveevrkaqraegpatvlaigtatpsncvdqatypdyyfritnsehktelkekfqrmcd
ksmikkrymylteeilkenptvceymapsldarqdmvvvevprlgkeaatkaikewgqpk
skithlvfcttsgvdmpgadyqltkllglrpyvkrlmmyqqgcfaggtvlrlakdlaenn
kgarvlvvcseitavtfrgpsdthldslvgqalfgdgaaaviigadplpevekp

Timeline for d5uc5b1:

• d5uc5b1 is new in SCOPe 2.06-stable
  
• d5uc5b1 appears in SCOPe 2.07
  
• d5uc5b1 appears in the current release, SCOPe 2.08