Lineage for d5uc5b1 (5uc5 B:2-235)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2917278Protein automated matches [226868] (6 species)
    not a true protein
  7. 2917279Species Apple (Malus domestica) [TaxId:3750] [342829] (1 PDB entry)
  8. 2917281Domain d5uc5b1: 5uc5 B:2-235 [342830]
    Other proteins in same PDB: d5uc5a2, d5uc5b2
    automated match to d1cmla1

Details for d5uc5b1

PDB Entry: 5uc5 (more details), 2.1 Å

PDB Description: chalcone synthase from malus domestica
PDB Compounds: (B:) CHS2 chalcone synthase

SCOPe Domain Sequences for d5uc5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uc5b1 c.95.1.2 (B:2-235) automated matches {Apple (Malus domestica) [TaxId: 3750]}
vtveevrkaqraegpatvlaigtatpsncvdqatypdyyfritnsehktelkekfqrmcd
ksmikkrymylteeilkenptvceymapsldarqdmvvvevprlgkeaatkaikewgqpk
skithlvfcttsgvdmpgadyqltkllglrpyvkrlmmyqqgcfaggtvlrlakdlaenn
kgarvlvvcseitavtfrgpsdthldslvgqalfgdgaaaviigadplpevekp

SCOPe Domain Coordinates for d5uc5b1:

Click to download the PDB-style file with coordinates for d5uc5b1.
(The format of our PDB-style files is described here.)

Timeline for d5uc5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5uc5b2