![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
![]() | Protein automated matches [226868] (5 species) not a true protein |
![]() | Species Apple (Malus domestica) [TaxId:3750] [342829] (1 PDB entry) |
![]() | Domain d5uc5b1: 5uc5 B:2-235 [342830] Other proteins in same PDB: d5uc5a2, d5uc5b2 automated match to d1cmla1 |
PDB Entry: 5uc5 (more details), 2.1 Å
SCOPe Domain Sequences for d5uc5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uc5b1 c.95.1.2 (B:2-235) automated matches {Apple (Malus domestica) [TaxId: 3750]} vtveevrkaqraegpatvlaigtatpsncvdqatypdyyfritnsehktelkekfqrmcd ksmikkrymylteeilkenptvceymapsldarqdmvvvevprlgkeaatkaikewgqpk skithlvfcttsgvdmpgadyqltkllglrpyvkrlmmyqqgcfaggtvlrlakdlaenn kgarvlvvcseitavtfrgpsdthldslvgqalfgdgaaaviigadplpevekp
Timeline for d5uc5b1: