Lineage for d5mtlc1 (5mtl C:4-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757918Domain d5mtlc1: 5mtl C:4-111 [342825]
    Other proteins in same PDB: d5mtla2, d5mtlb2, d5mtlc2, d5mtld2
    automated match to d1aqkl1

Details for d5mtlc1

PDB Entry: 5mtl (more details), 2.45 Å

PDB Description: crystal structure of an amyloidogenic light chain
PDB Compounds: (C:) light chain dimer,IGL@ protein,IGL@ protein

SCOPe Domain Sequences for d5mtlc1:

Sequence, based on SEQRES records: (download)

>d5mtlc1 b.1.1.0 (C:4-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltqppstsgtpgqrvtiscsgsssnietntvnwyqqlpgtapklvmhtnnqrpsgvpdrf
sgsrsgtsaslaigglqsedeadyfcaawddnlngvifgggtkltvlg

Sequence, based on observed residues (ATOM records): (download)

>d5mtlc1 b.1.1.0 (C:4-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltqppstsgtpgqrvtiscsgsssnietntvnwyqqlpgtapklvmhtnnqrpsgvpdrf
sgsrsgtsaslaigglqsedeadyfcaawdngvifgggtkltvlg

SCOPe Domain Coordinates for d5mtlc1:

Click to download the PDB-style file with coordinates for d5mtlc1.
(The format of our PDB-style files is described here.)

Timeline for d5mtlc1: