Lineage for d5on4b_ (5on4 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2485908Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2486640Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 2486645Species Escherichia coli [TaxId:562] [102695] (26 PDB entries)
  8. 2486696Domain d5on4b_: 5on4 B: [342820]
    automated match to d1zlqa1
    complexed with 9yk, fe, gol

Details for d5on4b_

PDB Entry: 5on4 (more details), 2.3 Å

PDB Description: crystal structure of nika in complex with fe-l1 (n-(2-hydroxybenzyl)- n'-(2-thiomethylbenzyl)-n,n'-ethylenediamine diacetic acid)
PDB Compounds: (B:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d5on4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5on4b_ c.94.1.1 (B:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
apdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgk
twtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqit
lksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrn
enywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtq
lsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpya
nlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiq
admrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqa
qqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelg
nipyapiateipfeqikp

SCOPe Domain Coordinates for d5on4b_:

Click to download the PDB-style file with coordinates for d5on4b_.
(The format of our PDB-style files is described here.)

Timeline for d5on4b_: