SCOPe 2.07: Domain d5ohjb_: 5ohj B:

Lineage for d5ohjb_ (5ohj B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48550] (31 PDB entries)
   Uniprot Q07343 324-667

8. Domain d5ohjb_: 5ohj B: [342806]
   automated match to d1f0jb_
   complexed with 9ve, mg, zn

Details for d5ohjb_

PDB Entry: 5ohj, 1.6 Å

PDB Description: human phosphodiesterase 4b catalytic domain in complex with a pyrrolidinyl inhibitor.

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d5ohjb_:

Sequence; same for both SEQRES and ATOM records:

>d5ohjb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
hplwetwadlvqpdaqdildtlednrnwyqsmipq

Timeline for d5ohjb_:

• d5ohjb_ first appeared in SCOPe 2.06
  
• d5ohjb_ appears in the current release, SCOPe 2.08