Lineage for d5njja_ (5njj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803365Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2803407Protein Numb [50762] (3 species)
  7. 2803411Species Human (Homo sapiens) [TaxId:9606] [342799] (1 PDB entry)
  8. 2803412Domain d5njja_: 5njj A: [342800]
    automated match to d2nmba_
    complexed with so4
    has additional insertions and/or extensions that are not grouped together

Details for d5njja_

PDB Entry: 5njj (more details), 2.7 Å

PDB Description: ptb domain of human numb isoform-1
PDB Compounds: (A:) Protein numb homolog

SCOPe Domain Sequences for d5njja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5njja_ b.55.1.2 (A:) Numb {Human (Homo sapiens) [TaxId: 9606]}
tdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkaerkffkgffgktgkkavka
vlwvsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwichcfma
vkdtgerlshavgcafaaclerk

SCOPe Domain Coordinates for d5njja_:

Click to download the PDB-style file with coordinates for d5njja_.
(The format of our PDB-style files is described here.)

Timeline for d5njja_: