Lineage for d5nwxa_ (5nwx A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. Family d.110.3.8: PAS domain of steroid receptor coactivator 1A, NCo-A1 [103187] (2 proteins)
  6. Protein PAS domain of steroid receptor coactivator 1A, NCo-A1 [103188] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [103189] (2 PDB entries)
  8. Domain d5nwxa_: 5nwx A: [342796]
    automated match to d1oj5a_

Details for d5nwxa_

PDB Entry: 5nwx (more details), 2.51 Å

PDB Description: insight into the molecular recognition mechanism of the coactivator ncoa1 by stat6
PDB Compounds: (A:) Nuclear receptor coactivator 1

SCOPe Domain Sequences for d5nwxa_:

Sequence, based on SEQRES records: (download)

>d5nwxa_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]}
vesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarqlfqevm
trgtasspsyrfilndgtmlsahtrcklcypqspdmqpfimgihiidr

Sequence, based on observed residues (ATOM records): (download)

>d5nwxa_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]}
vesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarqlfqevm
trgtasspsyrfilndgtmlsahtrcklcypqpfimgihiidr

SCOPe Domain Coordinates for d5nwxa_ are not available.

Timeline for d5nwxa_: