SCOPe 2.06: Domain d5n0ka3: 5n0k A:338-547

Lineage for d5n0ka3 (5n0k A:338-547)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (23 species)
   not a true protein

7. Species Rattus norvegicus [TaxId:10116] [342789] (1 PDB entry)

8. Domain d5n0ka3: 5n0k A:338-547 [342792]
   automated match to d1kcwa3
   complexed with ca, cu, na, nag

Details for d5n0ka3

PDB Entry: 5n0k, 2.3 Å

PDB Description: rat ceruloplasmin orthorhombic form

PDB Compounds: (A:) ceruloplasmin

SCOPe Domain Sequences for d5n0ka3:

Sequence; same for both SEQRES and ATOM records:

>d5n0ka3 b.6.1.0 (A:338-547) automated matches {Rattus norvegicus [TaxId: 10116]}
nkpspdddiqdrhvrhyyiaaeetiwdyapsgtdtftgenltslgsdsrvffeqgatrig
gsykklvyreytddsftnrkqrgpdeehlgilgpviwaevgdiirvtfhnkgqfplsiqp
mgvrftkenegtyygpdgrsskqashvapketftyewtvpkemgptyadpvclskmyysg
vdltkdiftgligpmkickkgslladgrqk

Timeline for d5n0ka3:

• d5n0ka3 is new in SCOPe 2.06-stable
  
• d5n0ka3 appears in SCOPe 2.07
  
• d5n0ka3 appears in the current release, SCOPe 2.08