Lineage for d5n0ka2 (5n0k A:192-337)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772598Species Norway rat (Rattus norvegicus) [TaxId:10116] [342789] (1 PDB entry)
  8. 2772600Domain d5n0ka2: 5n0k A:192-337 [342791]
    automated match to d1kcwa2
    complexed with ca, cu, na, nag

Details for d5n0ka2

PDB Entry: 5n0k (more details), 2.3 Å

PDB Description: rat ceruloplasmin orthorhombic form
PDB Compounds: (A:) ceruloplasmin

SCOPe Domain Sequences for d5n0ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n0ka2 b.6.1.0 (A:192-337) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nidqefvlmfsvvdenlswyledniktfcsepekvdkdnedfqesnrmysingytfgslp
glsmcaedrvkwylfgmgnevdvhsalfhgqaltsknyhtdiinlfpatlidvsmvaqnp
gvwmlscqnlnhlkaglqaffqvrdc

SCOPe Domain Coordinates for d5n0ka2:

Click to download the PDB-style file with coordinates for d5n0ka2.
(The format of our PDB-style files is described here.)

Timeline for d5n0ka2: