![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [342789] (1 PDB entry) |
![]() | Domain d5n0ka2: 5n0k A:192-337 [342791] automated match to d1kcwa2 complexed with ca, cu, na, nag |
PDB Entry: 5n0k (more details), 2.3 Å
SCOPe Domain Sequences for d5n0ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n0ka2 b.6.1.0 (A:192-337) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} nidqefvlmfsvvdenlswyledniktfcsepekvdkdnedfqesnrmysingytfgslp glsmcaedrvkwylfgmgnevdvhsalfhgqaltsknyhtdiinlfpatlidvsmvaqnp gvwmlscqnlnhlkaglqaffqvrdc
Timeline for d5n0ka2: