Lineage for d6b07c_ (6b07 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337969Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2337970Protein automated matches [196409] (38 species)
    not a true protein
  7. 2337980Species Choristoneura fumiferana [TaxId:7141] [342677] (4 PDB entries)
  8. 2337986Domain d6b07c_: 6b07 C: [342788]
    automated match to d4demf_
    complexed with c6m, edo, mg

Details for d6b07c_

PDB Entry: 6b07 (more details), 1.98 Å

PDB Description: crystal structure of cffpps2, a lepidopteran type-ii farnesyl diphosphate synthase, complexed with [1-phosphono-2-(1-propylpyridin- 2-yl)ethyl]phosphonic acid (inhibitor 1d)
PDB Compounds: (C:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d6b07c_:

Sequence, based on SEQRES records: (download)

>d6b07c_ a.128.1.0 (C:) automated matches {Choristoneura fumiferana [TaxId: 7141]}
sfedvlpsilntittnseltevpevanwlkkvleynlaggkkarglttlfayemlekpen
iteetiylaktlgwcveilqgflvmlddimdgsttrrgvpcwyqlpevglaavndsslmf
ssifyvlhahfadkkiytnlvelfneslmhtsigqhldvtmerrqksdyslftierynai
vkyktayytyqlpvclgmllanisdpvlhqkaedmcleigkffqiqddyidcygdesltg
kmgtdiqeakcswlavmalqrcsasqkivfttcygskepahierikelykqlqlpelyaq
eetrmyeslikqahglpselspalfvrlihmiykrnh

Sequence, based on observed residues (ATOM records): (download)

>d6b07c_ a.128.1.0 (C:) automated matches {Choristoneura fumiferana [TaxId: 7141]}
sfedvlpsilntittnseltevpevanwlkkvleynlaggkkarglttlfayemlekpen
iteetiylaktlgwcveilqgflvmlddimdgsttrrgvpcwyqlpevglaavndsslmf
ssifyvlhahfadkkiytnlvelfneslmhtsigqhldvtmersdyslftierynaivky
ktayytyqlpvclgmllanisdpvlhqkaedmcleigkffqiqddyidcygdesltgkmg
tdiqeakcswlavmalqrcsasqkivfttcygskepahierikelykqlqlpelyaqeet
rmyeslikqahglpselspalfvrlihmiykrnh

SCOPe Domain Coordinates for d6b07c_:

Click to download the PDB-style file with coordinates for d6b07c_.
(The format of our PDB-style files is described here.)

Timeline for d6b07c_: