SCOPe 2.08: Domain d5mp2d1: 5mp2 D:1-123

Lineage for d5mp2d1 (5mp2 D:1-123)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5mp2d1: 5mp2 D:1-123 [342786]
   Other proteins in same PDB: d5mp2c2, d5mp2d2
   automated match to d1mvfa_

Details for d5mp2d1

PDB Entry: 5mp2, 2.9 Å

PDB Description: xcpqn012 in complex with vhh04

PDB Compounds: (D:) Camelid nanobody VHH04

SCOPe Domain Sequences for d5mp2d1:

Sequence; same for both SEQRES and ATOM records:

>d5mp2d1 b.1.1.1 (D:1-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesgggsvqaggslrlscaasgntdssyymgwfrqgpgkeregvasiyiragipyy
tdsvkgrftisqdnakntiylqmnslkpedtamyfcagsvrttiqpfkgnyynywgrgtq
vtv

Timeline for d5mp2d1:

• d5mp2d1 first appeared in SCOPe 2.06
  
• d5mp2d1 appears in SCOPe 2.07