Lineage for d5k28a1 (5k28 A:43-102)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783437Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)
  8. 2783458Domain d5k28a1: 5k28 A:43-102 [342778]
    Other proteins in same PDB: d5k28a2, d5k28b2
    automated match to d2rf0d_

Details for d5k28a1

PDB Entry: 5k28 (more details), 1.5 Å

PDB Description: structure of the unbound sh3 domain of mlk3
PDB Compounds: (A:) Mitogen-activated protein kinase kinase kinase 11

SCOPe Domain Sequences for d5k28a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k28a1 b.34.2.0 (A:43-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvwtalfdyepsgqdelalrkgdrvevlsrdaaisgdegwwagqvggqvgifpsnyvsrg

SCOPe Domain Coordinates for d5k28a1:

Click to download the PDB-style file with coordinates for d5k28a1.
(The format of our PDB-style files is described here.)

Timeline for d5k28a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5k28a2