SCOPe 2.08: Domain d6azxb2: 6azx B:107-210

Lineage for d6azxb2 (6azx B:107-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6azxb2: 6azx B:107-210 [342769]
   Other proteins in same PDB: d6azxa_, d6azxb1, d6azxc_, d6azxd1
   automated match to d1dn0a2

Details for d6azxb2

PDB Entry: 6azx, 2.1 Å

PDB Description: crystal structure of the neutralizing anti-circumsporozoite protein 663 antibody

PDB Compounds: (B:) 663 antibody, light chain

SCOPe Domain Sequences for d6azxb2:

Sequence, based on SEQRES records:

>d6azxb2 b.1.1.2 (B:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfn

Sequence, based on observed residues (ATOM records):

>d6azxb2 b.1.1.2 (B:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkdnalqsgnsqesvteqd
skdstyslsstltlsdyekhkvyacevthqglsspvtksfn

Timeline for d6azxb2:

• d6azxb2 first appeared in SCOPe 2.06
  
• d6azxb2 appears in SCOPe 2.07