Lineage for d6enca3 (6enc A:461-610)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726099Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2726119Domain d6enca3: 6enc A:461-610 [342753]
    Other proteins in same PDB: d6enca1, d6enca2
    automated match to d3u9wa3
    complexed with act, bgw, imd, yb, zn

Details for d6enca3

PDB Entry: 6enc (more details), 1.95 Å

PDB Description: lta4 hydrolase in complex with compound11
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d6enca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6enca3 a.118.1.0 (A:461-610) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

SCOPe Domain Coordinates for d6enca3:

Click to download the PDB-style file with coordinates for d6enca3.
(The format of our PDB-style files is described here.)

Timeline for d6enca3: