![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
![]() | Superfamily d.126.1: Pentein [55909] (8 families) ![]() |
![]() | Family d.126.1.0: automated matches [191334] (1 protein) not a true family |
![]() | Protein automated matches [190175] (10 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:192222] [342731] (2 PDB entries) |
![]() | Domain d6b10b1: 6b10 B:1-325 [342732] Other proteins in same PDB: d6b10a2, d6b10b2 automated match to d1zbra1 complexed with k, po4 |
PDB Entry: 6b10 (more details), 2.09 Å
SCOPe Domain Sequences for d6b10b1:
Sequence, based on SEQRES records: (download)
>d6b10b1 d.126.1.0 (B:1-325) automated matches {Campylobacter jejuni [TaxId: 192222]} miksipewseqeylmlslpheksdwnpyleeilqsykefvkvvsefqkvlliapkqsdfe nfkdiknveffkcdtndtwirdfgaidivengrlkaldftfnawgnkfqseldnavnskl fkekfkeelkkvdfileggsidfngegvmltsshcllnenrnshlnktqidtklkeifgl kqiiwlengfikgddtdhhidtlarfidkntiahcicedeedehylplqkmkeelkktgf dllelpipkplyyeerrlgatyanfvfinnalivpfykdkndeiiakrlskalpnhkiig vdarvflrqngslhcscqnrfkglr
>d6b10b1 d.126.1.0 (B:1-325) automated matches {Campylobacter jejuni [TaxId: 192222]} miksipewseqeylmlslpheksdwnpyleeilqsykefvkvvsefqkvlliapkqsdfe nfkdiknveffkcdtndtwirdfgaidivengrlkaldftfnawgnkfqseldnavnskl fkekfkeelkkvdfileggsidfngegvmltsshcllnnshlnktqidtklkeifglkqi iwlengfikgdtdhhidtlarfidkntiahcicedeedehylplqkmkeelkktgfdlle lpipkplyyeerrlgatyanfvfinnalivpfykdkndeiiakrlskalpnhkiigvdar vflrqngslhcscqnrfkglr
Timeline for d6b10b1: