| Class b: All beta proteins [48724] (180 folds) |
| Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.17.1: PEBP-like [49777] (3 families) ![]() |
| Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins) |
| Protein Phosphatidylethanolamine binding protein, PEBP [49779] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [74891] (2 PDB entries) |
| Domain d6ensa_: 6ens A: [342724] automated match to d2iqxc_ complexed with act, gol |
PDB Entry: 6ens (more details), 1.3 Å
SCOPe Domain Sequences for d6ensa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ensa_ b.17.1.1 (A:) Phosphatidylethanolamine binding protein, PEBP {Mouse (Mus musculus) [TaxId: 10090]}
aadisqwagplclqevdeppqhalrvdyagvtvdelgkvltptqvmnrpssiswdgldpg
klytlvltdpdapsrkdpkfrewhhflvvnmkgndissgtvlsdyvgsgppsgtglhryv
wlvyeqeqplscdepilsnksgdnrgkfkvetfrkkynlgapvagtcyqaewddyvpkly
eqlsg
Timeline for d6ensa_: