Lineage for d6ensa_ (6ens A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774037Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2774038Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2774039Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)
  6. 2774047Protein Phosphatidylethanolamine binding protein, PEBP [49779] (4 species)
  7. 2774058Species Mouse (Mus musculus) [TaxId:10090] [74891] (2 PDB entries)
  8. 2774059Domain d6ensa_: 6ens A: [342724]
    automated match to d2iqxc_
    complexed with act, gol

Details for d6ensa_

PDB Entry: 6ens (more details), 1.3 Å

PDB Description: structure of mouse wild-type rkip
PDB Compounds: (A:) Phosphatidylethanolamine-binding protein 1

SCOPe Domain Sequences for d6ensa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ensa_ b.17.1.1 (A:) Phosphatidylethanolamine binding protein, PEBP {Mouse (Mus musculus) [TaxId: 10090]}
aadisqwagplclqevdeppqhalrvdyagvtvdelgkvltptqvmnrpssiswdgldpg
klytlvltdpdapsrkdpkfrewhhflvvnmkgndissgtvlsdyvgsgppsgtglhryv
wlvyeqeqplscdepilsnksgdnrgkfkvetfrkkynlgapvagtcyqaewddyvpkly
eqlsg

SCOPe Domain Coordinates for d6ensa_:

Click to download the PDB-style file with coordinates for d6ensa_.
(The format of our PDB-style files is described here.)

Timeline for d6ensa_: