Lineage for d6bcac_ (6bca C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448692Protein RhoA [52612] (1 species)
  7. 2448693Species Human (Homo sapiens) [TaxId:9606] [52613] (33 PDB entries)
    Uniprot P61586 2-181
  8. 2448716Domain d6bcac_: 6bca C: [342717]
    automated match to d4f38a_
    complexed with gsp, mg

Details for d6bcac_

PDB Entry: 6bca (more details), 2 Å

PDB Description: a complex between ph domain of lbcrhogef (akap-lbc) and activated rhoa bound to a gtp analog
PDB Compounds: (C:) transforming protein rhoa

SCOPe Domain Sequences for d6bcac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bcac_ c.37.1.8 (C:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

SCOPe Domain Coordinates for d6bcac_:

Click to download the PDB-style file with coordinates for d6bcac_.
(The format of our PDB-style files is described here.)

Timeline for d6bcac_: