SCOPe 2.08: Domain d5bk5e2: 5bk5 E:107-214

Lineage for d5bk5e2 (5bk5 E:107-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5bk5e2: 5bk5 E:107-214 [342714]
   Other proteins in same PDB: d5bk5a1, d5bk5b_, d5bk5c1, d5bk5d_, d5bk5e1, d5bk5f_, d5bk5g1, d5bk5h_
   automated match to d1dn0a2
   complexed with gol

Details for d5bk5e2

PDB Entry: 5bk5, 3 Å

PDB Description: crystal structure of the anti-circumsporozoite protein 663 germline antibody

PDB Compounds: (E:) 663 germline antibody, light chain

SCOPe Domain Sequences for d5bk5e2:

Sequence, based on SEQRES records:

>d5bk5e2 b.1.1.2 (E:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Sequence, based on observed residues (ATOM records):

>d5bk5e2 b.1.1.2 (E:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d5bk5e2:

• d5bk5e2 first appeared in SCOPe 2.06
  
• d5bk5e2 appears in SCOPe 2.07