![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
![]() | Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) ![]() |
![]() | Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
![]() | Protein automated matches [254706] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries) |
![]() | Domain d6enda1: 6end A:4-208 [342702] Other proteins in same PDB: d6enda2, d6enda3 automated match to d3b7sa2 complexed with act, bgk, imd, yb, zn |
PDB Entry: 6end (more details), 2.24 Å
SCOPe Domain Sequences for d6enda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6enda1 b.98.1.0 (A:4-208) automated matches {Human (Homo sapiens) [TaxId: 9606]} vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped psrkiykfiqkvpipcylialvvga
Timeline for d6enda1: