Lineage for d6enda1 (6end A:4-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820655Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2820656Protein automated matches [254706] (5 species)
    not a true protein
  7. 2820660Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)
  8. 2820685Domain d6enda1: 6end A:4-208 [342702]
    Other proteins in same PDB: d6enda2, d6enda3
    automated match to d3b7sa2
    complexed with act, bgk, imd, yb, zn

Details for d6enda1

PDB Entry: 6end (more details), 2.24 Å

PDB Description: lta4 hydrolase in complex with compound15
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d6enda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6enda1 b.98.1.0 (A:4-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek
vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt
sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped
psrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d6enda1:

Click to download the PDB-style file with coordinates for d6enda1.
(The format of our PDB-style files is described here.)

Timeline for d6enda1: