![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.17.1: PEBP-like [49777] (3 families) ![]() |
![]() | Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins) |
![]() | Protein Phosphatidylethanolamine binding protein, PEBP [49779] (4 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [346223] (1 PDB entry) |
![]() | Domain d6enta1: 6ent A:2-176 [342701] Other proteins in same PDB: d6enta2 automated match to d2iqxc_ complexed with cl, zn |
PDB Entry: 6ent (more details), 2.66 Å
SCOPe Domain Sequences for d6enta1:
Sequence, based on SEQRES records: (download)
>d6enta1 b.17.1.1 (A:2-176) Phosphatidylethanolamine binding protein, PEBP {Norway rat (Rattus norvegicus) [TaxId: 10116]} aadisqwagplslqevdeppqhalrvdyggvtvdelgkvltptqvmnrpssiswdgldpg klytlvltdpdapsrkdpkfrewhhflvvnmkgndissgtvlseyvgsgppkdtglhryv wlvyeqeqplncdepilsnksgkfkvesfrkkyhlgapvagtcfqaewddsvpkl
>d6enta1 b.17.1.1 (A:2-176) Phosphatidylethanolamine binding protein, PEBP {Norway rat (Rattus norvegicus) [TaxId: 10116]} aadisqwagplslqevdeppqhalrvdyggvtvdelgkvltptqvmnrpssiswdgldpg klytlvltdpdapsrkdpkfrewhhflvvnmkgndissgtvlseyvgsgppkdtglhryv wlvyeqeqplncdepsgkfkvesfrkkyhlgapvagtcfqaewddsvpkl
Timeline for d6enta1: