Lineage for d6b02a_ (6b02 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337969Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2337970Protein automated matches [196409] (38 species)
    not a true protein
  7. 2337980Species Choristoneura fumiferana [TaxId:7141] [342677] (4 PDB entries)
  8. 2337990Domain d6b02a_: 6b02 A: [342699]
    automated match to d4demf_

Details for d6b02a_

PDB Entry: 6b02 (more details), 2.82 Å

PDB Description: crystal structure of cffpps2 (apo form), a lepidopteran type-ii farnesyl diphosphate synthase
PDB Compounds: (A:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d6b02a_:

Sequence, based on SEQRES records: (download)

>d6b02a_ a.128.1.0 (A:) automated matches {Choristoneura fumiferana [TaxId: 7141]}
tkkesfedvlpsilntittnseltevpevanwlkkvleynlaggkkarglttlfayemle
kpeniteetiylaktlgwcveilqgflvmlddimdgsttrrgvpcwyqlpevglaavnds
slmfssifyvlhahfadkkiytnlvelfneslmhtsigqhldvtmerrqksdyslftier
ynaivkyktayytyqlpvclgmllanisdpvlhqkaedmcleigkffqiqddyidcygde
sltgkmgtdiqeakcswlavmalqrcsasqkivfttcygskepahierikelykqlqlpe
lyaqeetrmyeslikqahglpselspalfvrlihmiykrn

Sequence, based on observed residues (ATOM records): (download)

>d6b02a_ a.128.1.0 (A:) automated matches {Choristoneura fumiferana [TaxId: 7141]}
tkkesfedvlpsilntittnseltevpevanwlkkvleynlaggkkarglttlfayemle
kpeniteetiylaktlgwcveilqgflvmlddimdgsttrrgvpcwyqlpevglaavnds
slmfssifyvlhahfadkkiytnlvelfneslmhtsigqhldvtmerrqksdyslftier
ynaivkyktayytyqlpvclgmllanisdpvlhqkaedmcleigkffqiqddyidcygde
slgtdiqeakcswlavmalqrcsasqkivfttcygskepahierikelykqlqlpelyaq
eetrmyeslikqahglpselspalfvrlihmiykrn

SCOPe Domain Coordinates for d6b02a_:

Click to download the PDB-style file with coordinates for d6b02a_.
(The format of our PDB-style files is described here.)

Timeline for d6b02a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6b02b_