Lineage for d5trlf_ (5trl F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969076Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)
  8. 2969198Domain d5trlf_: 5trl F: [342675]
    automated match to d5gcna_
    complexed with sca

Details for d5trlf_

PDB Entry: 5trl (more details), 2.3 Å

PDB Description: crystal structure of human gcn5 histone acetyltransferase domain
PDB Compounds: (F:) Histone acetyltransferase KAT2A

SCOPe Domain Sequences for d5trlf_:

Sequence, based on SEQRES records: (download)

>d5trlf_ d.108.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiefhvignsltpkanrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlalikdg
rviggicfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltyadey
aigyfkkqgfskdikvpksrylgyikdyegatlmecelnpripyt

Sequence, based on observed residues (ATOM records): (download)

>d5trlf_ d.108.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiefhvignsanrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlalikdgrvig
gicfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltyadeyaigy
fkkqgfskdikvpksrylgyikdyegatlmecelnpripyt

SCOPe Domain Coordinates for d5trlf_:

Click to download the PDB-style file with coordinates for d5trlf_.
(The format of our PDB-style files is described here.)

Timeline for d5trlf_: