Lineage for d5o8ca1 (5o8c A:3-239)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) Protein Green fluorescent protein, GFP [54513] (6 species) Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
Uniprot P42212
Domain d5o8ca1: 5o8c A:3-239 [342673]
Other proteins in same PDB: d5o8ca2
automated match to d3st3a_
Details for d5o8ca1
PDB Entry: 5o8c (more details), 1.7 Å
PDB Description: composite structure of rsegfp2 1ps following 400nm-laser irradiation of the off-state.
PDB Compounds: (A:) Green fluorescent proteinSCOPe Domain Sequences for d5o8ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o8ca1 d.22.1.1 (A:3-239) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlxvlcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshnvyimadkqkngiksnfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagitlgmdelyk
SCOPe Domain Coordinates for d5o8ca1:
Click to download the PDB-style file with coordinates for d5o8ca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5o8ca1:
- d5o8ca1 first appeared in SCOPe 2.06
- d5o8ca1 appears in SCOPe 2.07
View in 3D
