Lineage for d1akca_ (1akc A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895168Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2895228Protein Aspartate aminotransferase, AAT [53385] (9 species)
  7. 2895239Species Chicken (Gallus gallus), mitochondria [TaxId:9031] [53386] (15 PDB entries)
  8. 2895254Domain d1akca_: 1akc A: [34266]
    complexed with ppe

Details for d1akca_

PDB Entry: 1akc (more details), 2.3 Å

PDB Description: structural basis for the catalytic activity of aspartate aminotransferase k258h lacking its pyridoxal-5'-phosphate-binding lysine residue
PDB Compounds: (A:) aspartate aminotransferase

SCOPe Domain Sequences for d1akca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akca_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]}
sswwshvemgppdpilgvteafkrdtnskkmnlgvgayrddngkpyvlncvrkaeamiaa
kkmdkeylpiagladftrasaelalgenseafksgryvtvqgisgtgslrvganflqrff
kfsrdvylpkpswgnhtpifrdaglqlqayryydpktcsldftgamediskipeksiill
hacahnptgvdprqeqwkelasvvkkrnllayfdmayqgfasgdinrdawalrhfieqgi
dvvlsqsyahnmglygeragaftvicrdaeeakrvesqlkilirpmysnppmngariasl
ilntpelrkewlvevkgmadriismrtqlvsnlkkegsshnwqhitdqigmfcftglkpe
qverltkefsiymtkdgrisvagvassnvgylahaihqvtk

SCOPe Domain Coordinates for d1akca_:

Click to download the PDB-style file with coordinates for d1akca_.
(The format of our PDB-style files is described here.)

Timeline for d1akca_: