Lineage for d5trmw_ (5trm W:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2575675Species Human (Homo sapiens) [TaxId:9606] [225745] (54 PDB entries)
  8. 2575812Domain d5trmw_: 5trm W: [342651]
    automated match to d5gcna_

Details for d5trmw_

PDB Entry: 5trm (more details), 2.9 Å

PDB Description: crystal structure of human gcn5 histone acetyltransferase domain
PDB Compounds: (W:) Histone acetyltransferase KAT2A

SCOPe Domain Sequences for d5trmw_:

Sequence, based on SEQRES records: (download)

>d5trmw_ d.108.1.0 (W:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iefhvignsltpkanrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlalikdgr
viggicfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltyadeya
igyfkkqgfskdikvpksrylgyikdyegatlmecelnpripyt

Sequence, based on observed residues (ATOM records): (download)

>d5trmw_ d.108.1.0 (W:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iefhvignslnrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlalikdgrvigg
icfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltyadeyaigyf
kkqgfskdikvpksrylgyikdyegatlmecelnpripyt

SCOPe Domain Coordinates for d5trmw_:

Click to download the PDB-style file with coordinates for d5trmw_.
(The format of our PDB-style files is described here.)

Timeline for d5trmw_: