Lineage for d5olca2 (5olc A:124-376)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837895Species Zobellia galactanivorans [TaxId:63186] [342332] (1 PDB entry)
  8. 2837896Domain d5olca2: 5olc A:124-376 [342640]
    Other proteins in same PDB: d5olca1, d5olca3, d5olcb1, d5olcb3, d5olcc1, d5olcc3, d5olcd1, d5olcd3, d5olce1, d5olce3, d5olcf1, d5olcf3, d5olcg1, d5olcg3, d5olch1, d5olch3
    automated match to d4ggba2
    complexed with mg

Details for d5olca2

PDB Entry: 5olc (more details), 2.79 Å

PDB Description: crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans
PDB Compounds: (A:) Galactonate dehydratase

SCOPe Domain Sequences for d5olca2:

Sequence, based on SEQRES records: (download)

>d5olca2 c.1.11.0 (A:124-376) automated matches {Zobellia galactanivorans [TaxId: 63186]}
vknpiiepyatglyftrtenleellveeallyksqgfkatkmkvglgieqdlkyiaairk
aigpdmrlmidsnhaycykeaielarkaekfdiswfeepvspedydgykrlrqnttipis
ggeceylkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwia
isaavhlvanldknpgrmyndlptmeldrtenalrdevtlhkiklenghlevpctpglgv
dvdmdklehyldk

Sequence, based on observed residues (ATOM records): (download)

>d5olca2 c.1.11.0 (A:124-376) automated matches {Zobellia galactanivorans [TaxId: 63186]}
vknpiiepyatglyleellveeallyksqgfkatkmkvglgieqdlkyiaairkaigpdm
rlmidsnhaycykeaielarkaekfdiswfeepvspedydgykrlrqnttipisggecey
lkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwiaisaavh
lvanldlptmeldrtenalrdevtlhkiklenghlevpctpglgvdvdmdklehyldk

SCOPe Domain Coordinates for d5olca2:

Click to download the PDB-style file with coordinates for d5olca2.
(The format of our PDB-style files is described here.)

Timeline for d5olca2: