![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) ![]() alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices |
![]() | Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins) Pfam PF03259 |
![]() | Protein automated matches [190414] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries) |
![]() | Domain d5y39c_: 5y39 C: [342638] automated match to d1veta_ |
PDB Entry: 5y39 (more details), 2.65 Å
SCOPe Domain Sequences for d5y39c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y39c_ d.110.7.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgsk lglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqvve v
Timeline for d5y39c_: