Lineage for d5y39b_ (5y39 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2971065Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2971066Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2971097Protein automated matches [190414] (3 species)
    not a true protein
  7. 2971107Species Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries)
  8. 2971118Domain d5y39b_: 5y39 B: [342625]
    automated match to d1szva_

Details for d5y39b_

PDB Entry: 5y39 (more details), 2.65 Å

PDB Description: crystal structure of ragulator complex (p18 76-145)
PDB Compounds: (B:) Ragulator complex protein LAMTOR2

SCOPe Domain Sequences for d5y39b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y39b_ d.110.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrngnqaf
nednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt

SCOPe Domain Coordinates for d5y39b_:

Click to download the PDB-style file with coordinates for d5y39b_.
(The format of our PDB-style files is described here.)

Timeline for d5y39b_: