Lineage for d5y5jb_ (5y5j B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331415Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species)
  7. 2331416Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (26 PDB entries)
    Uniprot P23295
  8. 2331439Domain d5y5jb_: 5y5j B: [342612]
    automated match to d1geja_
    complexed with gol, hem

Details for d5y5jb_

PDB Entry: 5y5j (more details), 2 Å

PDB Description: time-resolved sfx structure of cytochrome p450nor: dark-2 data in the presence of nadh (resting state)
PDB Compounds: (B:) NADP nitrous oxide-forming nitric oxide reductase

SCOPe Domain Sequences for d5y5jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y5jb_ a.104.1.1 (B:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif

SCOPe Domain Coordinates for d5y5jb_:

Click to download the PDB-style file with coordinates for d5y5jb_.
(The format of our PDB-style files is described here.)

Timeline for d5y5jb_: