Lineage for d5xhjb_ (5xhj B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331061Protein Cytochrome P450 bm-3 [48268] (2 species)
  7. 2331062Species Bacillus megaterium [TaxId:1348623] [342557] (7 PDB entries)
  8. 2331066Domain d5xhjb_: 5xhj B: [342609]
    automated match to d2x7ya_
    complexed with 87x, hem, trp

Details for d5xhjb_

PDB Entry: 5xhj (more details), 2 Å

PDB Description: crystal structure of p450bm3 with 5-cyclohexylvaleroyl-l-tryptophan
PDB Compounds: (B:) Bifunctional cytochrome P450/NADPH--P450 reductase

SCOPe Domain Sequences for d5xhjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xhjb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1348623]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd
petgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d5xhjb_:

Click to download the PDB-style file with coordinates for d5xhjb_.
(The format of our PDB-style files is described here.)

Timeline for d5xhjb_: