Lineage for d5yhja_ (5yhj A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2331742Species Exiguobacterium sp. [TaxId:360911] [342584] (1 PDB entry)
  8. 2331743Domain d5yhja_: 5yhj A: [342585]
    automated match to d1izoa_
    complexed with hem, myr

Details for d5yhja_

PDB Entry: 5yhj (more details), 2.3 Å

PDB Description: cytochrome p450ex alpha (cyp152n1) wild-type with myristic acid
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d5yhja_:

Sequence, based on SEQRES records: (download)

>d5yhja_ a.104.1.0 (A:) automated matches {Exiguobacterium sp. [TaxId: 360911]}
gkvipkqegldhsvdflregylfvanrrksfqsnifesrllgerviclggeeaaevfyda
nkftrqdaapkrllktlfgeggvqtldgsehthrkqmfmslmtkenidrllrltyrewnq
iermgeeivlydiaqevlmkavcewsgvplakeevgkrteemrllfesgtslgptylqgr
karssaevwirqmvkevrsnrllpnehtalyefswhrdesgellpeevvavevlnilrpt
vaisvyvlftvlalhqfpdvkeqvergevsktefvqevrrfypffpvaaarvktdfewdg
yafpegtltlldlygtnhdvsiwtepdrfdpsrfkdwkespfnfipqgggdvdfghrcag
ehvtiailaqvielftkeyaytvppqdlsysfvdmpslpksklrlthltrn

Sequence, based on observed residues (ATOM records): (download)

>d5yhja_ a.104.1.0 (A:) automated matches {Exiguobacterium sp. [TaxId: 360911]}
gkvipkqegldhsvdflregylfvanrrksfqsnifesrllgerviclggeeaaevfyda
nkftrqdaapkrllktlfgeggvqtldgsehthrkqmfmslmtkenidrllrltyrewnq
iermgeeivlydiaqevlmkavcewsgvplakeevgkrteemrllfesptylqgrkarss
aevwirqmvkevrsnrllpnehtalyefswhrdesgellpeevvavevlnilrptvaisv
yvlftvlalhqfpdvkeqvergevsktefvqevrrfypffpvaaarvktdfewdgyafpe
gtltlldlygtnhdvsiwtepdrfdpsrfkdwkespfnfipqgggdvdfghrcagehvti
ailaqvielftkeyaytvppqdlsysfvdmpslpksklrlthltrn

SCOPe Domain Coordinates for d5yhja_:

Click to download the PDB-style file with coordinates for d5yhja_.
(The format of our PDB-style files is described here.)

Timeline for d5yhja_: