Lineage for d5xopa1 (5xop A:1-65)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2319893Family a.39.1.5: Calmodulin-like [47502] (24 protein domains)
    Duplication: made with two pairs of EF-hands
  6. 2320473Protein automated matches [190064] (22 species)
    not a true protein
  7. 2320504Species Entamoeba histolytica [TaxId:885319] [342565] (1 PDB entry)
  8. 2320505Domain d5xopa1: 5xop A:1-65 [342578]
    Other proteins in same PDB: d5xopa2, d5xopb2, d5xopc2, d5xopd2, d5xope2
    automated match to d2m7ma_
    complexed with ca, mpd; mutant

Details for d5xopa1

PDB Entry: 5xop (more details), 1.9 Å

PDB Description: crystal structure of n-terminal domain ehcabp1 ef-2 mutant
PDB Compounds: (A:) Calcium-binding protein 1 (EhCBP1), putative

SCOPe Domain Sequences for d5xopa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xopa1 a.39.1.5 (A:1-65) automated matches {Entamoeba histolytica [TaxId: 885319]}
maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidkdgdgfidfeefak
fygsi

SCOPe Domain Coordinates for d5xopa1:

Click to download the PDB-style file with coordinates for d5xopa1.
(The format of our PDB-style files is described here.)

Timeline for d5xopa1: