Lineage for d5xopb1 (5xop B:1-65)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2324368Protein automated matches [190064] (22 species)
    not a true protein
  7. 2324399Species Entamoeba histolytica [TaxId:885319] [342565] (1 PDB entry)
  8. 2324401Domain d5xopb1: 5xop B:1-65 [342575]
    Other proteins in same PDB: d5xopa2, d5xopb2, d5xopc2, d5xopd2, d5xope2
    automated match to d2m7ma_
    complexed with ca, mpd; mutant

Details for d5xopb1

PDB Entry: 5xop (more details), 1.9 Å

PDB Description: crystal structure of n-terminal domain ehcabp1 ef-2 mutant
PDB Compounds: (B:) Calcium-binding protein 1 (EhCBP1), putative

SCOPe Domain Sequences for d5xopb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xopb1 a.39.1.5 (B:1-65) automated matches {Entamoeba histolytica [TaxId: 885319]}
maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidkdgdgfidfeefak
fygsi

SCOPe Domain Coordinates for d5xopb1:

Click to download the PDB-style file with coordinates for d5xopb1.
(The format of our PDB-style files is described here.)

Timeline for d5xopb1: