Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (21 species) not a true protein |
Species Entamoeba histolytica [TaxId:885319] [342565] (1 PDB entry) |
Domain d5xope1: 5xop E:1-65 [342572] Other proteins in same PDB: d5xopa2, d5xopb2, d5xopc2, d5xopd2, d5xope2 automated match to d2m7ma_ complexed with ca, mpd; mutant |
PDB Entry: 5xop (more details), 1.9 Å
SCOPe Domain Sequences for d5xope1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xope1 a.39.1.5 (E:1-65) automated matches {Entamoeba histolytica [TaxId: 885319]} maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidkdgdgfidfeefak fygsi
Timeline for d5xope1: