Lineage for d5xopc1 (5xop C:1-65)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
Duplication: made with two pairs of EF-hands
Protein automated matches [190064] (22 species)
not a true protein
Species Entamoeba histolytica [TaxId:885319] [342565] (1 PDB entry) 
Domain d5xopc1: 5xop C:1-65 [342570]
Other proteins in same PDB: d5xopa2, d5xopb2, d5xopc2, d5xopd2, d5xope2
automated match to d2m7ma_
complexed with ca, mpd; mutant
Details for d5xopc1
PDB Entry: 5xop (more details), 1.9 Å
PDB Description: crystal structure of n-terminal domain ehcabp1 ef-2 mutant
PDB Compounds: (C:) Calcium-binding protein 1 (EhCBP1), putativeSCOPe Domain Sequences for d5xopc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xopc1 a.39.1.5 (C:1-65) automated matches {Entamoeba histolytica [TaxId: 885319]}
maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidkdgdgfidfeefak
fygsi
SCOPe Domain Coordinates for d5xopc1:
Click to download the PDB-style file with coordinates for d5xopc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5xopc1:
View in 3D
