Lineage for d5wqua_ (5wqu A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2416559Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2416756Protein beta-Amylase [51481] (3 species)
    Common fold covers whole protein structure
  7. 2416784Species Sweet potato (Ipomoea batatas) [TaxId:4120] [51484] (3 PDB entries)
  8. 2416787Domain d5wqua_: 5wqu A: [342556]
    automated match to d1fa2a_
    complexed with mtt

Details for d5wqua_

PDB Entry: 5wqu (more details), 2.49 Å

PDB Description: crystal structure of sweet potato beta-amylase complexed with maltotetraose
PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d5wqua_:

Sequence, based on SEQRES records: (download)

>d5wqua_ c.1.8.1 (A:) beta-Amylase {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
apipgvmpignyvslyvmlplgvvnadnvfpdkekvedelkqvkaggcdgvmvdvwwgii
eakgpkqydwsayrelfqlvkkcglkiqaimsfhqcggnvgdavfipipqwilqigdknp
difytnragnrnqeylslgvdnqrlfqgrtalemyrdfmesfrdnmadflkagdivdiev
gcgaagelrypsypetqgwvfpgigefqcydkymvadwkeavkqagnadwempgkgagty
ndtpdkteffrpngtyktdmgkffltwysnkliihgdqvleeankvfvglrvniaakvsg
ihwwynhvshaaeltagfynvagrdgyrpiarmlarhhatlnftclemrdseqpaeaksa
pqelvqqvlssgwkeyidvagenalprydataynqmllnvrpngvnlngppklkmsglty
lrlsddllqtdnfelfkkfvkkmhadldpspnaispavlersnsaitidelmeatkgsrp
fpwydvtdmpvdgsnpfd

Sequence, based on observed residues (ATOM records): (download)

>d5wqua_ c.1.8.1 (A:) beta-Amylase {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
apipgvmpignyvslyvmlplgvvnadnvfpdkekvedelkqvkaggcdgvmvdvwwgii
eakgpkqydwsayrelfqlvkkcglkiqaimsfhqcggnvgdavfipipqwilqigdknp
difytnragnrnqeylslgvdnqrlfqgrtalemyrdfmesfrdnmadflkagdivdiev
gcgaagelrypsypetqgwvfpgigefqcydkymvadwkeavkqagnadwempgkgagty
ndtpdkteffrpngtyktdmgkffltwysnkliihgdqvleeankvfvglrvniaakvsg
ihwwynhvshaaeltagfynvagrdgyrpiarmlarhhatlnftclemrdseqpaeaksa
pqelvqqvlssgwkeyidvagenalprydataynqmllnvrpngvnlngppklkmsglty
lrlsddllqtdnfelfkkfvkkmhadldpsspavlersnsaitidelmeatkgsrpfpwy
dvtdmpvdgsnpfd

SCOPe Domain Coordinates for d5wqua_:

Click to download the PDB-style file with coordinates for d5wqua_.
(The format of our PDB-style files is described here.)

Timeline for d5wqua_: