Lineage for d1oxob_ (1oxo B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131052Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 2131063Species Chicken (Gallus gallus), mitochondria [TaxId:9031] [53386] (15 PDB entries)
  8. 2131073Domain d1oxob_: 1oxo B: [34255]
    complexed with ik2

Details for d1oxob_

PDB Entry: 1oxo (more details), 2.3 Å

PDB Description: aspartate aminotransferase, h-asp complex, open conformation
PDB Compounds: (B:) aspartate aminotransferase

SCOPe Domain Sequences for d1oxob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxob_ c.67.1.1 (B:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]}
sswwshvemgppdpilgvteafkrdtnskkmnlgvgayrddngkpyvlncvrkaeamiaa
kkmdkeylpiagladftrasaelalgenseafksgryvtvqgisgtgslrvganflqrff
kfsrdvylpkpswgnhtpifrdaglqlqayryydpktcsldftgamediskipeksiill
hacahnptgvdprqeqwkelasvvkkrnllayfdmayqgfasgdinrdawalrhfieqgi
dvvlsqsyaknmglygeragaftvicrdaeeakrvesqlkilirpmysnppmngariasl
ilntpelrkewlvevkgmadriismrtqlvsnlkkegsshnwqhitdqigmfcftglkpe
qverltkefsiymtkdgrisvagvassnvgylahaihqvtk

SCOPe Domain Coordinates for d1oxob_:

Click to download the PDB-style file with coordinates for d1oxob_.
(The format of our PDB-style files is described here.)

Timeline for d1oxob_: